PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC038973.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family TALE
Protein Properties Length: 452aa    MW: 50749.4 Da    PI: 6.2389
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC038973.10genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox291.9e-093754121954
                   HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
      Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                   Fe   ++yp+ +e+  LA+++gLt++q+++WF N R +
  EcC038973.10 375 FEHflHPYPNDSEKLMLASQTGLTKNQISNWFINARVR 412
                   664559******************************88 PP

2BELL93.32.2e-30236307172
          BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                   e++elq+k akL+slleeV+ r+ +y+  ++ v+ sFe vaglg+ak+Yt+lAl+a++rhF +L+dai++qi
  EcC038973.10 236 EKHELQAKLAKLVSLLEEVEARFMKYYFHMEEVALSFESVAGLGAAKSYTALALQAMTRHFCNLRDAIVSQI 307
                   689********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.9E-25169305IPR006563POX domain
PfamPF075262.1E-33173304IPR006563POX domain
PROSITE profilePS5007112.001353416IPR001356Homeobox domain
CDDcd000867.87E-12356417No hitNo description
SMARTSM003897.8E-10356420IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.606.0E-27361422IPR009057Homeodomain-like
SuperFamilySSF466891.07E-17362423IPR009057Homeodomain-like
PfamPF059203.0E-17373412IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 452 aa     Download sequence    Send to blast
MVTHESPPDP MPTAWHRFIP CESQFEGPDL SSYGSALRNN TAFFEPIGAV PSIQYHRERM  60
PRSINPVHSP VTVAESHITH TRHLMDLLEV ANVPNQAHSL TLSLNSPLPE PNTVQFGHRP  120
LGGTDFNSPS YVVPGESREA CDASNDSEFA SSSAPRNRQC FTSYRPDLVP SIIGNSTYLK  180
PAQSLLEEIV SICGNGAEIA NEKYLRKLYG GAERKATLGL VSELKEEFGN IGLPPEKHEL  240
QAKLAKLVSL LEEVEARFMK YYFHMEEVAL SFESVAGLGA AKSYTALALQ AMTRHFCNLR  300
DAIVSQIKIT RIKLFDDSSR ISCGLSRLSL FNRECSQKQR NSLQQLGLMH GQRQAWRPIR  360
GLPETSLAIL RSWLFEHFLH PYPNDSEKLM LASQTGLTKN QISNWFINAR VRLWKPMIEE  420
MYKEEFADSS EDSNPLIKGS ITDEDSTNLE DE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrm_B4e-16362420563Homeobox protein Meis2
4xrm_A4e-16362420563Homeobox protein Meis2
3k2a_B4e-16362420563Homeobox protein Meis2
3k2a_A4e-16362420563Homeobox protein Meis2
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010064623.10.0PREDICTED: BEL1-like homeodomain protein 11
SwissprotQ1PFD11e-92BLH11_ARATH; BEL1-like homeodomain protein 11
TrEMBLA0A059BQ860.0A0A059BQ86_EUCGR; Uncharacterized protein
STRINGVIT_18s0001g13130.t011e-166(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM97362734
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75430.17e-94BEL1-like homeodomain 11